SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010978368.1.60790 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010978368.1.60790
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.62e-39
Family Pseudouridine synthase II TruB 0.0000158
Further Details:      
 
Domain Number 2 Region: 151-231
Classification Level Classification E-value
Superfamily PUA domain-like 2.15e-18
Family PUA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010978368.1.60790
Sequence length 237
Comment tRNA pseudouridine(55) synthase TruB [Sulfolobus tokodaii]; AA=GCF_000011205.1; RF=representative genome; TAX=273063; STAX=111955; NAME=Sulfolobus tokodaii str. 7; strain=7; AL=Complete Genome; RT=Major
Sequence
MSYISSSGKEYVCLMQVHCDFNIDELKQIISKFIGIIYQKPPVRSSVKRRTRKKKIYDIE
ILDTDKRFILLRISSDPGTYMRKLCHDIGVILGCGAHMRELRRIRSGIFTEKNLVTLQEI
SEALYMWKNCKDESDLRKILLPMEYATCGMPKILIDDNAVDAISYGAMLTAPGIVAYQRF
RVKDTVAILTLKGELVAIGEADVDSQKLVDMKKGIVVKPKRVLMPRDIYPRSWKKHG
Download sequence
Identical sequences WP_010978368.1.60790 273063.ST0402 gi|15920607|ref|NP_376276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]