SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010983281.1.68722 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010983281.1.68722
Domain Number 1 Region: 42-399
Classification Level Classification E-value
Superfamily Sialidases 1.71e-85
Family Sialidases (neuraminidases) 0.0000231
Further Details:      
 
Domain Number 2 Region: 400-601
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-38
Family Clostridium neurotoxins, the second last domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010983281.1.68722
Sequence length 625
Comment neuraminidase [Streptomyces avermitilis]; AA=GCF_001514135.1; RF=na; TAX=33903; STAX=33903; NAME=Streptomyces avermitilis; strain=DSM 46492; AL=Scaffold; RT=Major
Sequence
MPSTLRARIASTLTAVLTTAALLALPSPAGAEQATDTGEFEQQVLFKASQDPGYACFRIP
AVVKTTDGTLLAFAEGRVLNCGDAADIDIVLKRSTDGGRTWGPLQVVNEGGGDTHGNPAP
VVDRETGRIVLAETYNTGRTDSAGCTVPCDRTPHLQYSDDDGLTWSRPRDLSDEILPPEW
NSWYATGPVHGIQLTRGRHAGRLVLGVNTETWDGSRVSANHAALITSDDGGDHWRIGATD
SWPIAADGTFRQKPSEMTLAERTDGSVLVSGREQDGTDLGHRTQAVSRDGGSSFTAPFRD
LPDLYTPQVQGSSLRLGDRLLLACPGDPDRRRTMTIRSSYDGGRTWDSVDRGTVVTTDWS
GYSDLVRVGRDTVGLMYEGGAVDARDEIRFARFTEDWLKPRRGPDPTTPDLAPHAKGAAV
LGGAEQTEGVFGGALDFDGADDAVRLPYRAELPLGTKDFTASLWFRYTAATGEQPLLWMG
GIGTSQPQVWLRGEPASNRVQGLITVRDGASAPQSAFVRTTGAYNDGQWHHLALRRGGGA
LTLFLDGTPISTADVPGSVSRNSPFGVHIGQRMDSRAYFTGSIDEVRVYGRALSDAEITG
LRTDNEASARDTVLRLPMDRVSGSH
Download sequence
Identical sequences Q82M18
227882.SAV_1842 WP_010983281.1.19017 WP_010983281.1.30226 WP_010983281.1.49792 WP_010983281.1.60620 WP_010983281.1.68722 gi|29828384|ref|NP_823018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]