SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_010985641.1.49792 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010985641.1.49792
Domain Number 1 Region: 13-37,73-231
Classification Level Classification E-value
Superfamily Prim-pol domain 6.34e-34
Family Bifunctional DNA primase/polymerase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010985641.1.49792
Sequence length 305
Comment DNA primase [Streptomyces avermitilis]; AA=GCF_000968255.1; RF=na; TAX=227882; STAX=33903; NAME=Streptomyces avermitilis MA-4680 = NBRC 14893; strain=MA-4680; AL=Scaffold; RT=Major
Sequence
MATTDRQATTLALAHALSAAERGLAVIPLSRTKLPALRSPHRATSDRTPSDRGTPRHDVP
GPTAPVCHGECGRFGHGVYDASTDPRRIRRLFAAAPWATGYGIACGLHPHFLIGIDLDTK
SGTDSSAALRELALRHLFTIPDTVVVLTPSGGRHVWLSGPPDVVVPNSAGRLAPGIDIRG
AGGYLVGPGSRTRHGVYSTAPGTARLAPAPCPTALLRLLTPPPRTHHPTPPATGEHGQGL
VQFVLAAHEGQRNTRLFWAACRAYENGIGPDLSPALIDAAVHTGLSEREARSTLASAARM
TGRRP
Download sequence
Identical sequences Q82FN8
227882.SAV_4214 WP_010985641.1.19017 WP_010985641.1.30226 WP_010985641.1.49792 WP_010985641.1.60620 WP_010985641.1.68722 gi|29830757|ref|NP_825391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]