SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010993725.1.39779 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010993725.1.39779
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.66e-59
Family Glycosyl hydrolases family 16 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010993725.1.39779
Sequence length 264
Comment MULTISPECIES: beta-glucanase [Bacteroides]; AA=GCF_000598865.1; RF=na; TAX=1339335; STAX=817; NAME=Bacteroides fragilis str. 3-F-2 #6; strain=3-F-2 #6; AL=Contig; RT=Major
Sequence
MKTKTFLALFCLLCISSGFSSCQRHSSDQWKLVWEDNFDQKTGFDPQVWSKIPRGKSDWN
NYMTDFDSCFDMRDGNMVLRGIINHSQPNDTAPYLTGGIYTKGKKAFSNGRLEIRAKLNG
ARGEWPAIWMLPIDAPWPMGGEIDIMERLNHDTIAYQTIHTNYTYNLGIKDNPLSHSVGA
INPDDYNVYSVEMYPDSIAFYINDTHTFTYPRIETDKEGQFPFDQPFYLLIDMQLGGSWV
GAVDPKELPVEMYVDWVRFYQKEK
Download sequence
Identical sequences A0A015TDH9 A0A015UZK7 A0A015V2S3 A0A0E2SNK0 A0A139TFW4 A0A149NML2 Q5L7Y7
gi|60683560|ref|YP_213704.1| 272559.BF4139 WP_010993725.1.10405 WP_010993725.1.21908 WP_010993725.1.23698 WP_010993725.1.30158 WP_010993725.1.35818 WP_010993725.1.37052 WP_010993725.1.37988 WP_010993725.1.38746 WP_010993725.1.39779 WP_010993725.1.53885 WP_010993725.1.56204 WP_010993725.1.58084 WP_010993725.1.60854 WP_010993725.1.6251 WP_010993725.1.63590 WP_010993725.1.7580 WP_010993725.1.91045 WP_010993725.1.95750 NYSGXRC-11268a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]