SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010996117.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010996117.1.33676
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ribosomal protein S16 2.35e-27
Family Ribosomal protein S16 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010996117.1.33676
Sequence length 86
Comment 30S ribosomal protein S16 [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MIKLRLKRFGKKREASYRIVAMNNLSRRDGRPLEELGYYNPRTDEVRLDVPGIVKRLQQG
AQPTDTVRRILQKQNVFEQVSAKPAS
Download sequence
Identical sequences A0A1W5CQU0 A0A1Z4KEZ4 Q3M4Y1 Q8YVM2
WP_010996117.1.33676 gi|75910554|ref|YP_324850.1| gi|17229445|ref|NP_485993.1| 103690.asr1953 240292.Ava_4357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]