SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010999233.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010999233.1.33676
Domain Number 1 Region: 25-346
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 487-681
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000166
Family Filamentous hemagglutinin FhaB, secretion domain 0.053
Further Details:      
 
Domain Number 3 Region: 346-483
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000659
Family P22 tailspike protein 0.069
Further Details:      
 
Weak hits

Sequence:  WP_010999233.1.33676
Domain Number - Region: 679-785
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 0.0719
Family HlyD-like secretion proteins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010999233.1.33676
Sequence length 885
Comment hypothetical protein [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MQLNFTGLALIGTIFISAIDNSSVHAQVIPDPTLNTTVTGSNHFTITNGSRVGNNLFHSF
SQFSFPINGSAFFNNAADIQNIFSRVTGGTVSNIDGLIRANGSANLFLLNPSGIIFGKNA
SLKIGGSFVATTAESIKFADGFKFSATSPLDSALLTLSVPIGLQMGSSPSSINVYGSKLA
IPARNTFALVGNNLTFDQSTITATDGRVELGSVAANNIVGLSANTTGFSLDFNTVAQFQD
INFSNVAKVDTSGNQGGAIALHGQKITLSGSSTITSHTLGTSSGQGILVKASESLELIGR
SSLSNTAIATHSQPTARGRGGDITIETPLLSVLNGAQINTRTNGIGDSGNITVKATTVNV
IGEAIHAPTKQRFSVSTLASNTMNGSQGRGGNVTIDATQVNIRDGGELRATARGTGDGGN
IIVTAKNLSVTGETATGEPAFLTGMSTSIREFATGRGGDIILNVGKLEVLNGPGIRTGTY
GEGTSGNIIVNADEVILGGSSSTGVATRFFASTNGNYDFSTDKLISLGQGQGGDITFNVG
KLNLLDGGRISTSTETYGKAGNIAIQANSINIAGVSQVPSGQLLYSLDATGPSGLYASST
GPGVAGSVYVTTKDLSLSDRTEIVVSGKGTGNAGNMLIQANYLKLDLASKLRSEANAGEG
GNIDLQVRDVLLMRNGSFISAEAVGNGGNIKITAPNIVGLENSDVIANAVQGRGGNIHIA
TQGIIGLQYRNLLNPREVLTNDITASSQFNVNGTVQINNIGVDPNSGLVELSENLTDPSQ
QIASGCSNNTGSSFVATGKGGVPQNPMQEMRSDRTWSDIRDISAFHKTELVQVQAQTPKS
PELLLQANSWRRNANGKIELTANQSPTQVQTALTCASVPQNKLML
Download sequence
Identical sequences A0A1Z4KNZ9 Q8YM34
gi|17232599|ref|NP_489147.1| 103690.all5107 WP_010999233.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]