SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010999236.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010999236.1.33676
Domain Number 1 Region: 21-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.39e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.0075
Further Details:      
 
Domain Number 2 Region: 412-551
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000251
Family P22 tailspike protein 0.066
Further Details:      
 
Domain Number 3 Region: 311-411
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.042
Further Details:      
 
Weak hits

Sequence:  WP_010999236.1.33676
Domain Number - Region: 552-645
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010999236.1.33676
Sequence length 795
Comment hypothetical protein [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MKITFANLSLLSAIYILVIGNISVHAQVTPDNTLNTSVSGSNHYSITNGTRVGNNLFHSF
SQFSIPNNGSALFDNASDVQNIFSRVTGGHVSTINGSINAKGSANVFLINPNGIIFGANA
RLNIGGSFVGTTANSIQFLDGVEFSATNPTISPLLTINIPLGLQFGQNPSAIQVQASGTQ
LQVPTGKTLALIGGDIFVDSRNLSTSQGRIEFGAVGEGTVSLTPNNLGWSLGYQDVQSFG
NIDLSNQTLLSTGGNGEIHLWGANVSLSGGSRVSIQNMTNVQTPGKISVHATKLLTVTGD
NPSGTTTSAVRAGAIGTGMVGNIEISTRDLMANNGGIILTSNISNSVGGGNITVNASGNI
QVAGVGKISTNRSGISGLTFLSGKGGDVSVVANRLEILDGSVVTTSTIGTGAAGNVTVKA
TESIELAGVETVSTSFAPSSLSSSTLAAGNSGNLIVNTARLSVQSGARVEASSYASGKAG
NVTLHATESIEVAGKPRQSFLIPSFIGSSTVQQAGTSRVLTGNSGDVQITTQQLKVANSG
LINVRNDGRGNAGMVKINVNSLVLNTQGAITAVTQMGEGGNIDVNTQTLLMRHNSAINAT
SNAIGDGGNITINSPIIVGLENSDIIANAVHGKGGNIQITTQGIIGLQYSPQLTSENDIT
ASSQFGVNGTVEVNNIGVDPKSGLIQLPANITDQSQQIASGCSNTTGSSFVATGRGGIPQ
NPTQEMRSDRTWSDIRDISAFQNRPQIQSQTPTQPQILIQATSWHRNTQGKIELVAEQSS
TQAQLSLTCAAISKS
Download sequence
Identical sequences A0A1Z4KP22 Q8YM31
103690.all5110 gi|17232602|ref|NP_489150.1| WP_010999236.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]