SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010999674.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010999674.1.33676
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00153
Family Intron-encoded homing endonucleases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010999674.1.33676
Sequence length 102
Comment HNH endonuclease [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MIQGKYPDNWKQLATALKAASNWRCSKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHRFGRGNVSPGQLSLFAEQKVS
Download sequence
Identical sequences A0A1Z4KUJ5 Q8YL21
WP_010999674.1.33676 NsR198 gi|17233133|ref|NP_490223.1|NC_003276 gi|17233133|ref|NP_490223.1| 103690.all7117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]