SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010999722.1.33676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010999722.1.33676
Domain Number 1 Region: 3-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-21
Family Beta-D-xylosidase C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_010999722.1.33676
Sequence length 183
Comment hypothetical protein [Nostoc sp. PCC 7120]; AA=GCF_000009705.1; RF=na; TAX=103690; STAX=103690; NAME=Nostoc sp. PCC 7120; AL=Complete Genome; RT=Major
Sequence
MEWLNEPPNWSHSDQKIIVTTSPKTDFWRITHYGFIRDSGHFYFDRVSTDFVVDVKIKGN
YKDLYDQAGIMIRADEQHWIKTGIEYVDGVQNLSAVVTHNYSDWSFTPLLNPPNIFQVRV
ERCQEAIHIAYLDEYSRYVPFRMAYFPVALDIQVGIMCASPQGNGYEVIFEDYQLTKKGE
KLS
Download sequence
Identical sequences Q8YKX3
WP_010999722.1.33676 gi|17233181|ref|NP_490271.1| gi|17233181|ref|NP_490271.1|NC_003276 103690.all7165 NsR24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]