SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011011188.1.13913 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011011188.1.13913
Domain Number 1 Region: 41-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-77
Family Glycosyl hydrolases family 16 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011011188.1.13913
Sequence length 297
Comment endo-beta-1,3-glucanase [Pyrococcus furiosus]; AA=GCF_000275605.1; RF=na; TAX=1185654; STAX=2261; NAME=Pyrococcus furiosus COM1; strain=COM1; AL=Complete Genome; RT=Major
Sequence
MKKEALLFLSLIFLVFVSGCIHHSTNQQLSSKQQVPEVIEIDGKQWRLIWHDEFEGSEVN
KEYWTFEKGNGIAYGIPGWGNGELEYYTENNTYIVNGTLVIEARKEIITDPNEGTFLYTS
SRLKTEGKVEFSPPVVVEARIKLPKGKGLWPAFWMLGSNIREVGWPNCGEIDIMEFLGHE
PRTIHGTVHGPGYSGSKGITRAYTLPEGVPDFTEDFHVFGIVWYPDKIKWYVDGTFYHEV
TKEQVEAMGYEWVFDKPFYIILNLAVGGYWPGNPDATTPFPAKMVVDYVRVYSFVSG
Download sequence
Identical sequences E7FHE7 I6V2Y2 O73951
WP_011011188.1.13913 WP_011011188.1.59273 186497.PF0076 gi|18976448|ref|NP_577805.1| Pfu-82406-001 gi|397652209|ref|YP_006492790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]