SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011011542.1.59273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011011542.1.59273
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-40
Family AlaX-like 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011011542.1.59273
Sequence length 149
Comment alanyl-tRNA editing protein AlaX [Pyrococcus furiosus]; AA=GCF_000007305.1; RF=representative genome; TAX=186497; STAX=2261; NAME=Pyrococcus furiosus DSM 3638; strain=DSM 3638; AL=Complete Genome; RT=Major
Sequence
MIEIRTHTALHVLKGAVVKVLGEGAKWTASVYVNGNHGRLTVKFNRKPTHEEIREIERLA
NEKIKENVPIQIYELSREEAEKIFGDEMYDLFPVPEHVRTLKVVVIEDWNVNACNKEHTK
TTGEIGEIKIRKVRFRKSKELLEISFDVL
Download sequence
Identical sequences I6UN86 Q8U3M9
gi|397650927|ref|YP_006491508.1| WP_011011542.1.13913 WP_011011542.1.59273 186497.PF0428 gi|18976800|ref|NP_578157.1| Pfu-435947-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]