SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011022463.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011022463.1.98848
Domain Number - Region: 45-89
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0767
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011022463.1.98848
Sequence length 396
Comment transposase [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MGKGNIAIDKSMIKTIVDGKIIIPLPKVLVENRYYPMFSIFSPTQCDSCGSKLHVNSHHT
RFIISRYGTISLNVTYWLCPTCKKHYHDRVIGVQGSANYSSEYYDTQINVRYDGRCSLHN
SRRIGETYTEGVINVCGRAPCPTSLWLYEQKLAKLSKQELLNQGVSFEETLYVDGNWIKN
GWKKKLEEFIGTKLTKKEWKKMRYKSVYVVATKEKVILDFEVTERLPTIEALMPLFIRIK
NRFPEDKIKKIVSDEDKAIIGAVKMVFPEVTHSFCVFHQLKNVSKRYYEEFSSVEEIPDN
DKITYNEISQLILSDTVISAVAHIQKIREFNSDLELSEASHKAISYAEEIFSKNVSFLKK
GFTPETDNTMEQIFSLICDIVDKVRSFKTDNGLTNF
Download sequence
Identical sequences Q8TH43
gi|20091323|ref|NP_617398.1| gi|20091581|ref|NP_617656.1| WP_011022463.1.98848 188937.MA2492 188937.MA2758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]