SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011022645.1.98848 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011022645.1.98848
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily RING/U-box 5.53e-27
Family Zf-UBP 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011022645.1.98848
Sequence length 86
Comment hypothetical protein [Methanosarcina acetivorans]; AA=GCF_000007345.1; RF=representative genome; TAX=188937; STAX=2214; NAME=Methanosarcina acetivorans C2A; strain=C2A; AL=Complete Genome; RT=Major
Sequence
MVCTHRDTIKVENFEPGEKGCEECLKSGDSWVHLRICLTCGHVGCCNQSKNKHATKHFEE
TGHPVIQSYQPGENWKYCYIDREYLK
Download sequence
Identical sequences Q8TMH2
188937.MA4679 WP_011022645.1.98848 gi|20091508|ref|NP_617583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]