SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011033944.1.82674 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011033944.1.82674
Domain Number 1 Region: 83-174
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000601
Family Eukaryotic type KH-domain (KH-domain type I) 0.00062
Further Details:      
 
Domain Number 2 Region: 2-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000658
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011033944.1.82674
Sequence length 182
Comment MULTISPECIES: RNA-processing protein [Methanosarcina]; AA=GCF_000970225.1; RF=na; TAX=1434114; STAX=2209; NAME=Methanosarcina mazei LYC; strain=LYC; AL=Complete Genome; RT=Major
Sequence
MTQYVKIPRERIGVIIGPKGEIKKLIEDKTTCQLEIESDSGKIDVTCEGDPLKEFRVLET
IKAIGRGFSPEKALEILDDEMLMLEVIDLSDVATTPKELQRIKGRIIGRNGRTRELAESL
INVKISVYGKTVSVLGYPEQNTIIRTAIKMLLDGATHGAVYKFLEKKHQELLHSQLDSVD
FY
Download sequence
Identical sequences A0A0E3Q0D1 A0A0E3RBF0 A0A0E3RHR0 A0A0E3RT18 A0A0E3RZT7 A0A0F8K3R5 M1PA99 Q8PVF3
gi|21228114|ref|NP_634036.1| 192952.MM_2012 gi|452210580|ref|YP_007490694.1| WP_011033944.1.12270 WP_011033944.1.13133 WP_011033944.1.13782 WP_011033944.1.14209 WP_011033944.1.14583 WP_011033944.1.14776 WP_011033944.1.15587 WP_011033944.1.16483 WP_011033944.1.16878 WP_011033944.1.18729 WP_011033944.1.18783 WP_011033944.1.21267 WP_011033944.1.21501 WP_011033944.1.2157 WP_011033944.1.21629 WP_011033944.1.21918 WP_011033944.1.23878 WP_011033944.1.24179 WP_011033944.1.29103 WP_011033944.1.29761 WP_011033944.1.32345 WP_011033944.1.33522 WP_011033944.1.40449 WP_011033944.1.41322 WP_011033944.1.43564 WP_011033944.1.43834 WP_011033944.1.44090 WP_011033944.1.4739 WP_011033944.1.49674 WP_011033944.1.4970 WP_011033944.1.53089 WP_011033944.1.53770 WP_011033944.1.57580 WP_011033944.1.58691 WP_011033944.1.61041 WP_011033944.1.61670 WP_011033944.1.62876 WP_011033944.1.63409 WP_011033944.1.64722 WP_011033944.1.65224 WP_011033944.1.66913 WP_011033944.1.7135 WP_011033944.1.7314 WP_011033944.1.73216 WP_011033944.1.73711 WP_011033944.1.74065 WP_011033944.1.75484 WP_011033944.1.75785 WP_011033944.1.76299 WP_011033944.1.7642 WP_011033944.1.76508 WP_011033944.1.8229 WP_011033944.1.82623 WP_011033944.1.82674 WP_011033944.1.83034 WP_011033944.1.8430 WP_011033944.1.84394 WP_011033944.1.90340 WP_011033944.1.9066 WP_011033944.1.90871 WP_011033944.1.91617 WP_011033944.1.94933 WP_011033944.1.95514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]