SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011036072.1.89271 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011036072.1.89271
Domain Number 1 Region: 2-301
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.76e-66
Family Proline iminopeptidase-like 0.000000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011036072.1.89271
Sequence length 313
Comment prolyl aminopeptidase [Xanthomonas campestris]; AA=GCF_000403555.1; RF=na; TAX=1281284; STAX=339; NAME=Xanthomonas campestris pv. campestris str. CN16; strain=CN16; AL=Chromosome; RT=Major
Sequence
MRTLYPEITPFDQGTLQVDDRHTLYFEQCGNPQGKPVVMLHGGPGGGCNTKMRRFHDPAK
YRIVLFDQRGAGRSTPHADLTDNTTWDLVADIERLRAHLGIDRWQVFGGSWGSTLALTYA
QTHPQQVTELVLRGIFLLRRWELEWFYQEGASRLFPDAWEHYIAAIPAEERHDLISAFHR
RLTSTDEATRLAAAKAWSVWEGATSFLHVDEDFVTGHEDAHFALAFARIENHYFVNGGFF
DAEDKLLRDAHRIAEIPGVIVQGRYDVVCPMQSAWELHKAWPKAELKISPAAGHSAFEPE
TVDALVRATDSFA
Download sequence
Identical sequences A0A0H2XCA1 Q8PC98
NP_636227.1.47755 WP_011036072.1.12496 WP_011036072.1.15229 WP_011036072.1.16446 WP_011036072.1.1732 WP_011036072.1.27778 WP_011036072.1.31612 WP_011036072.1.36111 WP_011036072.1.36449 WP_011036072.1.40219 WP_011036072.1.475 WP_011036072.1.56666 WP_011036072.1.89271 190485.XCC0836 314565.XC_3394 gi|66769696|ref|YP_244458.1| gi|21230310|ref|NP_636227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]