SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011037947.1.1732 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011037947.1.1732
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-50
Family Methylesterase CheB, C-terminal domain 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011037947.1.1732
Sequence length 343
Comment chemotaxis protein-glutamate methylesterase [Xanthomonas campestris]; AA=GCF_900039355.1; RF=na; TAX=1358024; STAX=339; NAME=Xanthomonas campestris pv. campestris str. CFBP 4956; strain=CFBP4956; AL=Scaffold; RT=Major
Sequence
MVDNDLHPQQHRDVIVIGGSAGAGEALRRLLGALPAQTPAAILVVLHMSAHGHGIMRTVS
AGANGITVVEAADGMRIEPHTLYVAVADRHLMVADGRIVLGTGPRENMSRPSIDALFRSA
AVAFGPRTVGVLLSGMLNDGTAGLDAIHACGGTVLVQDPGEAVASDMPLSALQRVPADAV
RSSAELGGLIAELAQTAAGPARVITDALRLEVAIARGALTTTDDTARIATPVAMSCPACG
GVLSQISESSVLRFRCQVGHAYTGESLLSATEGSVDEALRIALRIIDERATLVARMADSN
TRAQPNTAAMYRHRADEYRGYADTLRKALLRKSPLAAAVEPSE
Download sequence
Identical sequences NP_638170.2.47755 WP_011037947.1.12496 WP_011037947.1.1732 WP_011037947.1.27778 WP_011037947.1.31612 WP_011037947.1.40219 WP_011037947.1.475 WP_011037947.1.56666 190485.XCC2822 314565.XC_1290 gi|77747904|ref|NP_638170.2| gi|77761145|ref|YP_242379.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]