SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011052791.1.80602 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011052791.1.80602
Domain Number 1 Region: 56-335
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.33e-73
Family alpha-L-arabinanase-like 0.0000235
Further Details:      
 
Domain Number 2 Region: 356-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-17
Family Beta-D-xylosidase C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011052791.1.80602
Sequence length 540
Comment MULTISPECIES: xylosidase [Xanthomonas]; AA=GCF_000961255.1; RF=na; TAX=611301; STAX=346; NAME=Xanthomonas citri subsp. citri; strain=MN10; AL=Complete Genome; RT=Major
Sequence
MADTTRRDVFKGLAAGALVAPLAAAAQASATQRAGTPQWARGVEGQRKADLGNGTYLNPI
VAGDHPDPTILKDGDDYYMTFSSFFSYPGIVLWHSTDLVNWTPIGPALHQGLGTIWALDL
CKHHDRYYIYIPANPDDTGWSIFVIWADDIRGPWSAPIDLKIAGCIDPGHVVGEDGKRYL
FVNGIRKVRLRDDGLATDGQLEPAYAPWRYPDHWVVENFAPEGPKLTWHDGWLYLVTAVG
GTAGPVTGHMVIAARSRSVHGPWEHCPRNPLVRTQSDQEPWWSRGHATLVEGPRGDWWMV
YHGYENGFRTLGRQTLLEPIEWTADGWFRAIGGDLSKPLRTPARVPAGSMAPATGLALSD
DFSSDRFGTQWSLHAPRPGEQARVRRANKALTLACAGSSPIDSTPLTCGVPDRAYMAEVT
LELVGDAEGGIVLFYNHKAFVGIGFTADTMKTYEYSEELVWARAPNTHRRIRVRLTNDHQ
VVGFEYSVDAGQQWARHPTRMEVSGFHHNVFGGFLSLQLGVYAAQQGEVVLRDFRYRALT
Download sequence
Identical sequences A0A0U5FL10 A0A1T1S1Q8 M4TZZ1 Q8PF05
gi|21244900|ref|NP_644482.1| XaR244 gi|470473990|ref|YP_007638558.1| 190486.XAC4183 WP_011052791.1.101581 WP_011052791.1.13318 WP_011052791.1.13350 WP_011052791.1.14945 WP_011052791.1.18336 WP_011052791.1.19505 WP_011052791.1.21004 WP_011052791.1.22678 WP_011052791.1.28779 WP_011052791.1.29860 WP_011052791.1.30380 WP_011052791.1.30778 WP_011052791.1.31392 WP_011052791.1.3308 WP_011052791.1.35047 WP_011052791.1.35540 WP_011052791.1.37228 WP_011052791.1.38217 WP_011052791.1.39696 WP_011052791.1.41216 WP_011052791.1.41431 WP_011052791.1.42745 WP_011052791.1.43799 WP_011052791.1.43832 WP_011052791.1.46272 WP_011052791.1.47707 WP_011052791.1.53417 WP_011052791.1.56030 WP_011052791.1.56391 WP_011052791.1.56804 WP_011052791.1.58382 WP_011052791.1.59630 WP_011052791.1.60328 WP_011052791.1.61945 WP_011052791.1.62531 WP_011052791.1.6260 WP_011052791.1.63386 WP_011052791.1.6829 WP_011052791.1.70193 WP_011052791.1.71126 WP_011052791.1.71284 WP_011052791.1.72810 WP_011052791.1.76206 WP_011052791.1.79879 WP_011052791.1.80421 WP_011052791.1.80602 WP_011052791.1.82073 WP_011052791.1.87455 WP_011052791.1.88516 WP_011052791.1.88706 WP_011052791.1.88988 WP_011052791.1.89206 WP_011052791.1.90138 WP_011052791.1.90200 WP_011052791.1.90226 WP_011052791.1.92002 WP_011052791.1.92041 WP_011052791.1.92912 WP_011052791.1.94705 WP_011052791.1.96706 WP_011052791.1.99816 gi|471265672|ref|YP_007648137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]