SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011077098.1.43808 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011077098.1.43808
Domain Number - Region: 82-176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0744
Family Legume lectins 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011077098.1.43808
Sequence length 1123
Comment hypothetical protein [Mycoplasma penetrans]; AA=GCF_000011225.1; RF=representative genome; TAX=272633; STAX=28227; NAME=Mycoplasma penetrans HF-2; strain=HF-2; AL=Complete Genome; RT=Major
Sequence
MSKLSKKITLSAITSVLSIATGLSIGLPISNNSLKNSSITNISSSNQSTTASKLAPSEAN
DQNANLSTSNGPITFLGNKITALDWYGNKLWEKDLSTLIPDYNGKVSTDGSATNYDNGPW
KRAWFNWDYNRNTDLLWIIGYWSPVTKKQPLLGIKASSGDIQHNYDIDYQSYTSSLGATT
TGTAYRFVSALASGKVMIYGGAATAYNGKGLLFNPSDSTLTLLNGNSATESIFPPNDSEY
GTKYRWYFFNLIPIGNNKNFVEVLPFSRDATTGDAGYPNANYNVYFLLVDDNLNLIETTG
TWSKLVKVADGMQNYRNTKITPQRDYYTMLDGKVVTVVYNTAIVINATGNSINYGTYPMS
EAKWIKSWAFDSNQNLYFKFKDESTIYKVSGSAWSSLNNNTSSAIAPNTYLDLAGIPQTK
DYANNLIIYNVYGYTGQLMMVNSKYNENVDTSNSGITEDANPDKLGLALAVTQNANSQNQ
GDYKGILNGDDSIQKASDFELSQSAIDSKIPSEITRSDINTLNSSFLKNASDFTITKIDD
ANGTIEIQCNLYQIPWFASELPSNITPRVVTHQYTTTNKINNKISWKTLSETTDYDFLNM
KPSKIAVDDVTNLDPFQVSFQSQIITTAQGQQLYPKKTYSVSDPNDTAGTIKVSVKYEYV
PMGLSYSTNNVKSYETNFTYTVFKSTDTPAFRFTGQTTSGSSASIDVSNVAELKNLLNAS
TLPSSFNYLNSSTDSTNSAFLQFINTANSKGYPISKMKFTVTADDVAGTLKITATMPASY
SPKNSEETFTVTYTNLNKAANYKFNFKTSSSSIGSQNFSTLLPSSITDGDIINNLIEYQG
FNSNDFTITKTANDQNGTLLVQISLNSSYASAIGNGNAGFKNYSATHTFTGFMNEDQYNE
RFNVEFVDDSSEVLIDLKQMQSSQVYDTLVTKNTSLTVGNTTYNNLKELVEKLLITKLGS
LVPTGWKDNASIDVGMYYDNSQGTASFYVNIPKSLMAGANSDLNLVANYTGFLKGNAVQT
NDNLSFVSDNMLKNYLISKGFVTKEQYEAFTAASFAEWLKEDNNAIKLITYKTGQYEQLL
NDPTKYSINIVANTTQKTVSVYIHFNGITDSNSLSEYSVVYAI
Download sequence
Identical sequences Q8EWD4
gi|26553724|ref|NP_757658.1| WP_011077098.1.43808 272633.MYPE2710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]