SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011086656.1.90507 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011086656.1.90507
Domain Number 1 Region: 73-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.88e-22
Family GntR ligand-binding domain-like 0.007
Further Details:      
 
Domain Number 2 Region: 5-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.54e-18
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011086656.1.90507
Sequence length 217
Comment MULTISPECIES: transcriptional regulator [Bradyrhizobium]; AA=GCF_000261765.1; RF=na; TAX=502063; STAX=502063; NAME=Bradyrhizobium sp. CCBAU 41267; strain=CCBAU 41267; AL=Contig; RT=Major
Sequence
MILLRENIYDRLRSDILACRFAPGDEMREQDLAERYEVSRQPVRDALLRLQREHLVTVQP
RQGYRVTPISLADARDLLRFRLALEPACVAEAIESAPDSVLKSLDEFRRFAGNHEDFIAY
NRAFHSALAHASGNRRMATALCDLIGQADRLVRVSISNLRGHDPAKLVAEHVALIDAMQS
RETRTAARIIKAHIGATEKRVLPALKRNAVIVEERSS
Download sequence
Identical sequences A0A2A6N0P4 Q89NG3
224911.bll3877 gi|27378988|ref|NP_770517.1| NP_770517.1.11505 WP_011086656.1.15658 WP_011086656.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]