SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011088031.1.67972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011088031.1.67972
Domain Number 1 Region: 23-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000143
Family GntR-like transcriptional regulators 0.056
Further Details:      
 
Domain Number 2 Region: 102-233
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000732
Family GntR ligand-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011088031.1.67972
Sequence length 255
Comment MULTISPECIES: transcriptional regulator [Bradyrhizobium]; AA=GCF_001280585.1; RF=na; TAX=375; STAX=375; NAME=Bradyrhizobium japonicum; strain=Is-1; AL=Scaffold; RT=Major
Sequence
MARRKRALEVVRNEDDGEGKPSRRNRLNFFELAYQRIEELLVHCELKPGQFMTMLELQHI
TGFGRTPVHHAVNRLSADTLIIIRPRHGLHIAPIDLARERMLLALRRDMERFVVRLAADR
ASLSHRNQALHIERLLRERRATLTLDEFNHIDRRIDALVLEAAGEPFLVHTLRPLHTLYR
RIGYIHHRFMPGQADLSGTIDHHLAILAAVASRRVDDAVKASDALIDYMGEMFTGMEAGI
DPRLLDCSIEPLLGA
Download sequence
Identical sequences A0A0E4FZ59 A0A0M9BB29 Q89JK8
NP_771915.1.11505 WP_011088031.1.15658 WP_011088031.1.2739 WP_011088031.1.53516 WP_011088031.1.53518 WP_011088031.1.67972 WP_011088031.1.69380 WP_011088031.1.90507 gi|27380386|ref|NP_771915.1| 224911.bll5275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]