SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011089549.1.53518 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011089549.1.53518
Domain Number 1 Region: 84-218
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-25
Family GntR ligand-binding domain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 14-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-19
Family GntR-like transcriptional regulators 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011089549.1.53518
Sequence length 236
Comment MULTISPECIES: transcriptional regulator [Bradyrhizobium]; AA=GCF_000648595.1; RF=na; TAX=754504; STAX=1355477; NAME=Bradyrhizobium diazoefficiens SEMIA 5080; strain=SEMIA 5080; AL=Contig; RT=Major
Sequence
MQLMKSNVELASDSIVDRVYEQLKAMAVSYEFKPGERLNEGELAKRLGVSRTPLREALNR
LNTEGFLRFTPGKGFFCRELDAHEIFDLYELRKSIEVASVRLAIKRAKDEDIDALLKFLE
ATGPDPGERSSVELVELDETFHERLMAMSNNAEMLRVLRNVNARIRFVRWIDMDRVNRSN
TQAEHRAVVEGLKARNEEACVSVLEKHIDRRLDRITSAIKEGYAQIYMPAARSAAN
Download sequence
Identical sequences A0A0E4BL28 A0A0M9B5Q4 Q89F91
gi|27381921|ref|NP_773450.1| NP_773450.1.11505 WP_011089549.1.15658 WP_011089549.1.2739 WP_011089549.1.53516 WP_011089549.1.53518 WP_011089549.1.67972 WP_011089549.1.69380 WP_011089549.1.90507 224911.bll6810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]