SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011090694.1.90507 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011090694.1.90507
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.6e-24
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 11-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.46e-20
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011090694.1.90507
Sequence length 231
Comment MULTISPECIES: transcriptional regulator [Bradyrhizobium]; AA=GCF_000261765.1; RF=na; TAX=502063; STAX=502063; NAME=Bradyrhizobium sp. CCBAU 41267; strain=CCBAU 41267; AL=Contig; RT=Major
Sequence
MMGAPMRSLKLDTPKSLSQRVMQRLRQAIIDGEFALGAAISEEMVANSFGVSRTPVREAM
GQLQAQGLVVIRPQVGSFVFTPSADDIAALCTFRIALEPKAAELAFRHDRDGAVATMSEA
IAAMEPAVSARDNIAYGRADAAFHEALFTHCGNRYLVESYQLVSGRVAALRTNLTSPIDV
RTRTSFDEHRKLLDLFARGEFAAFEALMTTHITNSGVVYAKALKVEALKVE
Download sequence
Identical sequences A0A2A6MP22 Q89C27
gi|27383082|ref|NP_774611.1| NP_774611.1.11505 WP_011090694.1.15658 WP_011090694.1.90507 224911.blr7971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]