SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011099509.1.12609 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011099509.1.12609
Domain Number 1 Region: 293-465
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-46
Family Ribonuclease PH domain 1-like 0.0000138
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-43
Family Ribonuclease PH domain 1-like 0.0000219
Further Details:      
 
Domain Number 3 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.57e-25
Family Ribonuclease PH domain 2-like 0.0032
Further Details:      
 
Domain Number 4 Region: 450-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.79e-24
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 
Domain Number 5 Region: 607-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-21
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 
Domain Number 6 Region: 236-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.48e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0022
Further Details:      
 
Domain Number 7 Region: 554-620
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.35e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011099509.1.12609
Sequence length 705
Comment polyribonucleotide nucleotidyltransferase [Clostridium tetani]; AA=GCF_900167265.1; RF=na; TAX=1513; STAX=1513; NAME=Clostridium tetani; strain=ATCC 19406; AL=Scaffold; RT=Major
Sequence
MSHVLETDIAGRTLKVEYGKVGMLSNCAILVSYGDTVVLINANASKEPRDGIDFFPLSVE
YEERLYSVGKIPGGFIKREGRPTENAILHARAIDRPLRPLFPKGYRNDVQIVCTVLSVES
DNQPDILAMNGASLALCLSSIPFTTPVANVSVGLINGDFILNPTQSQREESILNLTVSAT
KERVMMIEAGAEEVDEDTMYNAIRFGFEQCQKIVEFQEEAMRRFGKEKVEPVLYLVDKDI
EKEVREFAFPMVKEAMYISDKDLRNEKIDEVKEKVKEEFEEKYPENDSDISEALYKMQKE
VVRNMILREKRRPDERAFDEIRKISCEVGLLPRTHGTGLFTRGLTQVMTAATIGPLADVQ
ILDSIEDEEFKRYMHHYNFPSYSVGETRPLRGPGRREIGHGALAEKALEPLIPSEEDFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPIKRPAAGIAMGLVTNDDLTEEKILTDI
QGIEDFFGDMDFKVAGTEKGITALQVDTKISGLSDNCIKETLIKAKDARMYILGKIKECI
PEHRAELSPYAPRVYTMTIAPEKIRDVIGAGGKTINKIIGETGVQIDIKEDGKIYVMSSD
SVGANRALKMINDLTKDVEAGEIYLGKVTRTTNFGAFVEILPGKEGLVHISKLDFTRVNK
VEDVVSVGDEILVKVTDIDDQGRINLSRRDAIKKEEDEKTKENNH
Download sequence
Identical sequences A0A1T4P308 Q895J3
212717.CTC01280 gi|28210966|ref|NP_781910.1| WP_011099509.1.12609 WP_011099509.1.27827 WP_011099509.1.49058 WP_011099509.1.81004 WP_011099509.1.83101 WP_011099509.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]