SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011107589.1.19130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011107589.1.19130
Domain Number 1 Region: 176-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-16
Family Clostridium neurotoxins, the second last domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011107589.1.19130
Sequence length 395
Comment hypothetical protein [Bacteroides thetaiotaomicron]; AA=GCF_900109385.1; RF=na; TAX=818; STAX=818; NAME=Bacteroides thetaiotaomicron; strain=KPPR-3; AL=Scaffold; RT=Major
Sequence
MAFGVLALVHTACENAKYDVIDNLVYINEASTSKTKELTLTEGTTRTSLTVRLVNIINQT
IKANLFIDESVLDAYNKKNETNYKMPPKEYISFPESVTIEAGSVSADPVNVDIKSFEAEG
GAQYAIPISIKNVEGGIEKSESSSSFLLVLVKPLKQAVPKLTWYNGMHAAPEGAWGLALP
NYTLEWWSKVTSKSGNGGYTKNNQAIINSGGLGTELYIRFGDLIYSENGSYKNNFLQVKT
MGSQFDTGDPTKGKGLEAQKWYHFAVSYDAASGTTLLYQNGTVVASLSSSIGQPMNIDQF
QMISSGEEYFPDFCEMCQVRFWKVTRTVNQIKKSMYTEVDYTDKNLLLYLPMNEGEGATI
LHDVTGNGHDVEIGNSNLGNENRQKVTWETYSFAQ
Download sequence
Identical sequences Q8A8Y0
APC81431 NP_809950.1.73244 WP_011107589.1.19130 WP_011107589.1.81417 WP_011107589.1.83447 gi|29346447|ref|NP_809950.1| 226186.BT_1037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]