SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011107902.1.24025 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011107902.1.24025
Domain Number - Region: 152-253
Classification Level Classification E-value
Superfamily CalX-like 0.00366
Family CalX-beta domain 0.021
Further Details:      
 
Domain Number - Region: 351-568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0528
Family Glycosyl hydrolases family 16 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011107902.1.24025
Sequence length 593
Comment DUF5006 domain-containing protein [Bacteroides thetaiotaomicron]; AA=GCF_001816245.1; RF=na; TAX=818; STAX=818; NAME=Bacteroides thetaiotaomicron; strain=14-106904-2; AL=Contig; RT=Major
Sequence
MKNILYKILPVCLLTIGLTGCEDETKYRPLPEAVPLTMSINEKAFVMGEHLKVDIKVEPD
ADGNEVVANEDFDIYFTAKAGTEDVANVFEPFSSIVTFPKGEKQIQVDFPVKTSGLVGTT
TMEFVAFARGYKMANSSQGIKVSDYYRISMSLENNTENVVTEGGKFVLVAKVDKPSSVPL
EVTITPKEGEEGRYDNLPSTLTIPAGRTSVKSAAVTIKQDYEMTGDLQLVLNLKSNSSSN
PMTAPALTITMTDLESMADPDLYDMTTVYENPNIMFVSYDDDWFTGKETAKMDEGTAHPN
AELGSQWKFDYAIEFHKNSTSGDYQKLGNATDANRGNVLKIDWIKYAKVTDEGELNICVG
VEGTNYGTAGIHCCKSLGQMWAQNVTRIYPGMRIEMKVRLGGNRTGFVPMIEVKNPATAT
TCKEAKQSICILKNVSGSAITQSVRGEVVSDAKSVVSAIPKVEDYNIYWVELVDENTIKL
GINGSTTLEVTRDMLDSWPFTKASTGTSVGAKGLYLVMRMDLFGEGNSVSSELPAGWDTE
LKSINPANYATEGPRMIIDWIRFYVNDNYKREANELVNRDYKVSIPGKFYQFY
Download sequence
Identical sequences A0A2J6A270 Q8A796
226186.BT_1629 gi|29347039|ref|NP_810542.1| NP_810542.1.73244 WP_011107902.1.24025 WP_011107902.1.81417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]