SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011108169.1.59346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011108169.1.59346
Domain Number 1 Region: 52-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-27
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011108169.1.59346
Sequence length 317
Comment hypothetical protein [Bacteroides thetaiotaomicron]; AA=GCF_001578565.1; RF=na; TAX=818; STAX=818; NAME=Bacteroides thetaiotaomicron; strain=KLE1254; AL=Scaffold; RT=Major
Sequence
MYTHLTDMTNMLDTAKIGTSDGTFPLANAQNLQKAVEELQTGISKGMAGYFVLQYEIDNY
CIAAEKAIAEFQDSYQQTLQPGTPAELKVFGIDGKGRIEFGSDPAYGGGNTFTVESWVKY
DAGFFESGIGSFLSTFDGKQPNEGWMINFLGSNLRTTIGMGPQEGRVLEEGRAYPDNFGK
WNHVVTVWDNTLPEGQLKMYVNGELFFSKTNDVKNDAGVLQNYMPNTRNQNMWAFQEPTD
NSRCMTGFIKKFRMWSTAKSANEVKTLMNSDVTGTESGLVCAWDFTTVVEDVTNIPDKTG
KHVAKIVGNYKWFKVEN
Download sequence
Identical sequences A0A139KVY9 Q8A5N5
gi|29347613|ref|NP_811116.1| APC81706 226186.BT_2203 NP_811116.1.73244 WP_011108169.1.29471 WP_011108169.1.59346 WP_011108169.1.81417 WP_011108169.1.83447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]