SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011110817.1.55826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011110817.1.55826
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-51
Family Ribonuclease PH domain 1-like 0.0000198
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-46
Family Ribonuclease PH domain 1-like 0.0000132
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.41e-31
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 450-546
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 555-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 6 Region: 612-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.12e-20
Family Cold shock DNA-binding domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011110817.1.55826
Sequence length 708
Comment polyribonucleotide nucleotidyltransferase [Nitrosomonas europaea]; AA=GCF_900106625.1; RF=na; TAX=915; STAX=915; NAME=Nitrosomonas europaea; strain=Nm50; AL=Contig; RT=Major
Sequence
MKPIKKSITYGRHTLTIETGEIAKQAHGAVIVSMDDTVVLVTAVGDKKTKPGQDFFPLTV
DYQEKFYSAGRIPGSFFKREGRPSEKETLTSRLIDRPIRPLFPDGFYNEVQVVAMVLSSD
TEIDADIPAMIGTSAALILSGIPFDGPVGAARVGYINNEYILNPTTTQLKESQLNLVVAG
TQKAVLMVESEADELSEDVMLGAVTYGHDQMQQVIDMINELADEAGVTAWDWQPAEQDLS
LVEKVTQLAEADLRNAFRLKQKSARVEAINEIWQRVFTELKVGTEEGPSEQAVREIGFAL
EARIVRNSILDGESRIDGRGTRTVRPITIRHGVLPRTHGSALFTRGETQALAITTLGTAR
DEQKIDALQGDYSERFMLHYNMPPFATGETGRVGTPKRREIGHGRLAKRALLAVIPPVEE
FGYSMRVVSEVTESNGSSSMASVCGGCLSLMDAGVPLKAHVAGIAMGLIKEGNRFAVLTD
ILGDEDHLGDMDFKVAGTEHGITALQMDIKIQGITKEIMQVALLQAKEGRLHILEIMKQS
LPIARESISVHAPRIIKFKINPEKIRDVIGKGGAVIRALTEETGTTIDISDDGSVTIACV
SSEGGEQARKRIEDITADVEVGRIYEGTVLKLLDFGAIVSVLPGKDGLLHISQIANERVE
NVADHLKEGQTVRVKVLEADEKGRLRLSMKAASISTEITADNPDNTEK
Download sequence
Identical sequences A0A1I0DRX5 Q82XT0
gi|30248196|ref|NP_840266.1| WP_011110817.1.11244 WP_011110817.1.14462 WP_011110817.1.55826 WP_011110817.1.61914 228410.NE0172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]