SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011115436.1.84735 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011115436.1.84735
Domain Number 1 Region: 299-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-40
Family Ribonuclease PH domain 1-like 0.00013
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-37
Family Ribonuclease PH domain 1-like 0.00027
Further Details:      
 
Domain Number 3 Region: 455-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.24e-21
Family Ribonuclease PH domain 2-like 0.00025
Further Details:      
 
Domain Number 4 Region: 148-241
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.09e-20
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 560-633
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 630-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000425
Family Cold shock DNA-binding domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011115436.1.84735
Sequence length 709
Comment polyribonucleotide nucleotidyltransferase [Helicobacter hepaticus]; AA=GCF_000007905.1; RF=representative genome; TAX=235279; STAX=32025; NAME=Helicobacter hepaticus ATCC 51449; strain=ATCC 51449; AL=Complete Genome; RT=Major
Sequence
MQHIKLEFENLSEQYSFNYVAQAANGGILYQNGGSVLLASVCTQENEKYDDEFLPLSVQY
IEKTYANNKFPSGFIKREGKPSEFEILTSRLIDRTLRPLFPKGYTYITSIVVMVLSYDGK
SDLQLNALNAAACALYVSDLPLESLQDKAVSGVRIGRKDGHFIINPTMEQLSESELNLFV
SGRDDELLMIEMKSIRTAQGANELSEENFLEALECAKNYIKNATQTYHQQFAPYKKSPFA
FESANDELDEQLLNIIQTHYHTPITEAIKHMAKSERHTQLKALIKQVVRECEIEDEKKVQ
EHIMAYKRKLVREMILQSHIRADGRGLKDVRPISIQTNILPFAHGSVLFTRGQTQALVSA
TIGGDNDAQNYEMLGSKNALKKRFLFHYNFPSFSVGEASMIGSVGRRELGHGNLAKRALH
SSVQEQDKTIRLVSEILESNGSSSMASVCGGSLALCACGIKVESLIAGVAMGLVTQDEQC
AILTDISGLEDHDGDMDFKVAGGYKGISAMQMDIKLGGITQEILCQALFQAKEAREQILA
IMEEARAKIVLNDVILPKSESFMIPPHKIVEVIGAGGRVIKDIIERFEVSIDLARESGMV
SVSASNVENLQKAKTFILQLVSSAGTKKEYEKVDWESYAVGERFVGKIKKIVDFGIFVEL
PRGGDGLIHISKITKDKTQQLSEIFHNVSELECEILSQNKNKVELGLVE
Download sequence
Identical sequences Q7VIL0
235279.HH0594 WP_011115436.1.84735 gi|32266093|ref|NP_860125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]