SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011144929.1.100813 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011144929.1.100813
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.8e-35
Family SMI1/KNR4-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011144929.1.100813
Sequence length 139
Comment hypothetical protein [Photorhabdus luminescens]; AA=GCF_000196155.1; RF=na; TAX=243265; STAX=29488; NAME=Photorhabdus luminescens subsp. laumondii TTO1; strain=TTO1; AL=Complete Genome; RT=Major
Sequence
MNTKLNDVIEEIERLSDGQRNDVDLPDDELISQYEKEIGFEFSNDYKEVLKKISNIFYGT
IDLLSVTRDKKYYGELSQALSDAREQGLPENLLPICEDNGSYYCIDYDGKIKYWTLDGYN
EESWPDLASWIKQVWIEGN
Download sequence
Identical sequences A0A2D0IRN0 Q7M7B0
243265.plu0547 243265.plu1139 243265.plu1148 WP_011144929.1.100813 WP_011144929.1.49830 gi|37524553|ref|NP_927897.1| gi|37525107|ref|NP_928451.1| gi|37525116|ref|NP_928460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]