SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011153630.1.35395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011153630.1.35395
Domain Number 1 Region: 37-317,415-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.14e-67
Family FAD-linked reductases, N-terminal domain 0.00085
Further Details:      
 
Domain Number 2 Region: 298-405
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.97e-31
Family L-aminoacid/polyamine oxidase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011153630.1.35395
Sequence length 458
Comment amine oxidase [Synechocystis sp. PCC 6803]; AA=GCF_000009725.1; RF=na; TAX=1148; STAX=1148; NAME=Synechocystis sp. PCC 6803; strain=PCC 6803; AL=Complete Genome; RT=Major
Sequence
MIRRRSFFKLSQLMFVSYLLSTSCGKNNTPVTANDAPSILIIGAGLAGLAAAQSLMKQGY
TVRVLEARDRLGGRTWTSNYWDDAPLDMGASWIQGTEGNPITELAEKIATPLVMTSYDNA
ITYEVGGQPFTAKEDRIIEQLEKKWQGAIATAQNGDGDQSLQAVIENVFDLENQPLETKQ
IIDWYMNSTIEHEYAGSLKDTSIYWFDGDGGFGGDDAIFVEGYQAIVNYLAKDISIELNQ
IVESIDYSEEIPKIITNQGAYTADQVIITLPLGVLKSGQVKFIPELPSPKRKAIKALGMG
ILNKCYLRFPKVFWPKKVDWIEQVPTERGLWSEWVNIFRVNQLPILLGFNAADEGKEIET
WTDEEIIKSAMKTLRHLFGDDIPDPTDYQITRWQSDSFSRGSYSFNALGSHPDMRDHLAK
SLNDQIFFAGEATERDYFATAHGAYLSGLRVAEEINNL
Download sequence
Identical sequences Q6ZEN7
1148.slr5093 gi|38505628|ref|NP_942249.1|NC_005229 gi|451816636|ref|YP_007459839.1|NC_020296 WP_011153630.1.1889 WP_011153630.1.35395 gi|38505628|ref|NP_942249.1| gi|38505628|ref|NP_942249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]