SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011166606.1.37196 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011166606.1.37196
Domain Number 1 Region: 307-458
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.49e-30
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 195-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000543
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011166606.1.37196
Sequence length 509
Comment MULTISPECIES: ribonuclease Y [Mycoplasma mycoides group]; AA=GCF_000959055.1; RF=na; TAX=2103; STAX=2102; NAME=Mycoplasma mycoides subsp. mycoides; strain=B237; AL=Contig; RT=Major
Sequence
MNDDIIILLSVFCGIFFICFIICSSIALYLWKSKSRKRLVEQYTKEAKQAKKQILANGYK
EISEAKMLFLKRSELEKNELDRVKEQLELRSNDLKRNQEIVESKSQRLDASLLDLEKRKF
LLDKKEEYLIKILEDASGLTKSQAKELLIKQVKNKSEKELISILKNAELQAHSSSKMIAN
NIIISAMERIKVELTSQRTTNIVKLPSDDLKGRIIGKDGRNMKAFEQIGGVDIVVDETPN
TVVVSSFNPIRREIATRTLEQLIIDGRIQPIKIENELKKQEQELEYIIQETGLSTIKELN
INDIDIELVKLIGKLKFRTSYGQNVLAHSIEVAKLSGAIASELGLDVEKAIRAGLLHDIG
KAIDFEKQGSHVVLGAEIAKKYNEDPIIINCIESHHEDKEKESEIAAIVAIADSISASRP
GARYNAIDEFILRMTEIEKIGNSIPGVAKTYALQSGRQIRLIVNPLVASDLDLAMILEKM
KEEIKNKVIIPGEITITVIRERKETDVLK
Download sequence
Identical sequences A0A126SU45 Q6MTI6
272632.MSC_0422 NP_975408.1.55851 WP_011166606.1.11018 WP_011166606.1.17500 WP_011166606.1.23723 WP_011166606.1.32010 WP_011166606.1.3214 WP_011166606.1.37196 WP_011166606.1.51345 WP_011166606.1.72634 WP_011166606.1.84266 gi|42560957|ref|NP_975408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]