SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011169931.1.70455 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011169931.1.70455
Domain Number 1 Region: 26-333
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.38e-109
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000212
Further Details:      
 
Domain Number 2 Region: 333-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011169931.1.70455
Sequence length 497
Comment MULTISPECIES: glycosyl hydrolase family 32 [Pseudomonas syringae group genomosp. 2]; AA=GCF_000012205.1; RF=na; TAX=264730; STAX=29438; NAME=Pseudomonas savastanoi pv. phaseolicola 1448A; strain=1448A; BAA-978; AL=Complete Genome; RT=Major
Sequence
MNGPMSNTLERAHHALKDSLAQVIHDYRPGYHLAPPAGWMNDPNGVVYFRGEYHVFYQHH
PFDAKWGPMYWGHAKSADLVHWQHLPIALAPGDDFDQDGCFSGSAVVCGDTLALIYTGHT
WLGEVGDELLIRQVQCLATSLDGINFVKHGAVIDSPPQDTIIHFRDPKVWQQDDHWYLIA
GARLGDRPLLPLYRSVDLHAWEFVSYVSSGNEGDGYMWECPDLFRLDGRDVLLYSPQGMP
AQGYERLNKFHTGYRVGQIDSQRQFNGGPFIELDNGHDFYAAQTLVAADGRRLVWAWLDM
WESPTPTATHLWRGMLGLPRELELRDDRLCVHPARELTALRNASLPGTPWWSEAGTQWLT
DVHGDLLEIHVHLDLLDCTEGHLGVALRCSSDGKEQTLLYYDASLKRLILDRDQSGTHVS
GQRSVAIDPQQERLELRVFLDRSSIEVFDQNGSFSFSSRLYPQTDSLGVKLIANGTGGRV
CIANAWELSSGCLQVNH
Download sequence
Identical sequences Q48BH6
gi|71736148|ref|YP_277269.1| WP_011169931.1.10739 WP_011169931.1.12791 WP_011169931.1.27185 WP_011169931.1.28195 WP_011169931.1.70455 WP_011169931.1.86037 264730.PSPPH_5192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]