SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011185880.1.68452 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011185880.1.68452
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Cgl1923-like 3.92e-74
Family Cgl1923-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011185880.1.68452
Sequence length 309
Comment PAC2 family protein [Leifsonia xyli]; AA=GCF_001708285.1; RF=na; TAX=59736; STAX=1575; NAME=Leifsonia xyli subsp. xyli; strain=gdw1; AL=Contig; RT=Major
Sequence
MRDPGELFELTSALEVPDGLPLVAGLTGFADAGSGVSQLGTYLLATLHSEVVATFDADIL
LDYRARRPIIYFDQDHLDGYQPSTLKLYLVYDELRQPFLLLSGFEPDFRWEAFTEAVLGL
MERFRVKSVTWVHAIPMPVPHTRPIGVTVSGNRAELIEAMSIWKPQTQVPANALHLLEFR
LQPLSYPIAGFVLLIPHYLADAEYPAAAITGLESISAATGLIFPTDRLREDDRQFVANIN
EQVAGNAELGRLVGTLENRHDSYMEDNQPRSPLTDRDGELPSADEIAAELENFLAFRRHG
DEDNSRGDR
Download sequence
Identical sequences A0A1E2SKX5 Q6AFG1
281090.Lxx10170 gi|50954701|ref|YP_061989.1| WP_011185880.1.68452 WP_011185880.1.84704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]