SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011185880.1.84704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011185880.1.84704
Domain Number 1 Region: 6-267
Classification Level Classification E-value
Superfamily Cgl1923-like 3.92e-74
Family Cgl1923-like 0.00000518
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011185880.1.84704
Sequence length 309
Comment PAC2 family protein [Leifsonia xyli]; AA=GCF_000007665.1; RF=na; TAX=281090; STAX=1575; NAME=Leifsonia xyli subsp. xyli str. CTCB07; strain=CTCB07; AL=Complete Genome; RT=Major
Sequence
MRDPGELFELTSALEVPDGLPLVAGLTGFADAGSGVSQLGTYLLATLHSEVVATFDADIL
LDYRARRPIIYFDQDHLDGYQPSTLKLYLVYDELRQPFLLLSGFEPDFRWEAFTEAVLGL
MERFRVKSVTWVHAIPMPVPHTRPIGVTVSGNRAELIEAMSIWKPQTQVPANALHLLEFR
LQPLSYPIAGFVLLIPHYLADAEYPAAAITGLESISAATGLIFPTDRLREDDRQFVANIN
EQVAGNAELGRLVGTLENRHDSYMEDNQPRSPLTDRDGELPSADEIAAELENFLAFRRHG
DEDNSRGDR
Download sequence
Identical sequences A0A1E2SKX5 Q6AFG1
gi|50954701|ref|YP_061989.1| WP_011185880.1.68452 WP_011185880.1.84704 281090.Lxx10170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]