SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011215912.1.25566 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011215912.1.25566
Domain Number 1 Region: 198-353
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 6.41e-75
Family RalF, C-terminal domain 0.0000000845
Further Details:      
 
Domain Number 2 Region: 6-194
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-59
Family Sec7 domain 0.0000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011215912.1.25566
Sequence length 398
Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella pneumophila]; AA=GCF_001766315.1; RF=na; TAX=91891; STAX=446; NAME=Legionella pneumophila subsp. pneumophila; strain=FFI104; AL=Complete Genome; RT=Major
Sequence
MPSEIEKAQRDITEAFNAKPKNGIEKIKEICEENKISPNEEIAAFFHQQRKNLDLEAVGD
YLSGPEAENQQVLKAFTSQMDFNGQSFVEGLRTFLKTFKLPGEAQKIDRLVQSFSAAYSQ
QNPDVVSNADAAYLLAFQTIMLNTDLHNPSIPEKNKMTVDGLKRNLRGGNNGGDFDAKFL
EELYSEIKAKPFELNFVKTSPGYELNSTTLNKDSTFKKLNSFLYSTDANINTVFPGIGDN
VKTTVDQPKSWLSFFTGYKGTITLTDKQTSAQATIQVYTPNIFSKWLFGEQPRVIIQPGQ
TKESIDLAAKAAAGFSSPVKNFKATYDYEVGDLIKAYDNQKKLISPNKNMVIKGSIFRTP
NAEQRETSKSATRTVNTDYDINEDTVTRKDESRSSYKK
Download sequence
Identical sequences Q5WV98
gi|54294840|ref|YP_127255.1| WP_011215912.1.25566 WP_011215912.1.40024 WP_011215912.1.47557 WP_011215912.1.62869 WP_011215912.1.84649 WP_011215912.1.85655 WP_011215912.1.85818 WP_011215912.1.93162 297245.lpl1919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]