SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011229399.1.38154 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229399.1.38154
Domain Number 1 Region: 19-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000867
Family ArsC-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011229399.1.38154
Sequence length 137
Comment MULTISPECIES: CopG family transcriptional regulator [Cupriavidus]; AA=GCF_000812445.1; RF=na; TAX=1539143; STAX=1539143; NAME=Cupriavidus sp. SHE; strain=SHE; AL=Contig; RT=Major
Sequence
MKYLFAAAILAGSAASYAAAPAMTVYKDPNCGCCEEWVKHINQAGFPPKVINSTDVTSVK
TRLGVPASFSSCHTAVLETSGQVIEGHVPASAIQKLVANRAVKGVAVPGMPTNAPGMGKL
NGGLVTVDFQGKPFSQD
Download sequence
Identical sequences A0A2E9S116 Q58AE2 Q9F3R7
gi|56130773|ref|YP_145676.1|NC_006466 gi|94152520|ref|YP_581927.1|NC_007971 NYSGXRC-10176c 266264.Rmet_6118 gi|94152520|ref|YP_581927.1| WP_011229399.1.12480 WP_011229399.1.22474 WP_011229399.1.38154 WP_011229399.1.481 WP_011229399.1.52493 WP_011229399.1.63697 WP_011229399.1.66126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]