SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011243745.1.95485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243745.1.95485
Domain Number 1 Region: 22-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-117
Family GABA-aminotransferase-like 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011243745.1.95485
Sequence length 399
Comment MULTISPECIES: pleiotropic regulatory protein [Synechococcus]; AA=GCF_000012525.1; RF=na; TAX=1140; STAX=32046; NAME=Synechococcus elongatus PCC 7942; strain=PCC 7942; AL=Complete Genome; RT=Major
Sequence
MCSSSECPVTSIPAFNLTEQYRRIGAELETATAKVLASGGYIGGQTVADFEAAFAAAMGV
TEAVGCNSGTDALHLALRALDIGPGDEVITSPFTFFASAEAISLAGATPVLVDIEPQFFN
LDYRQIEAAITPRTKAIIPVHLFGHPAAMSEIMAIARAHNLRVIEDCAQATGATWQGQPV
GSFGDCGCFSFYPTKNLGACGDGGLVTTKNPEVADRLRSLRQHGMRVRYYHDEIGLNSRL
DALQAVILSIKLRYLDEWNQQRQAIAQRYGEAIAAIPGLVAPSVHADAVHVWHQYTVRVQ
ACGDRSRCVSHPCDRQGLCRDWLQQQLQAQGIGSMIYYPVPVHLQQAYSQLGYKTGDFPE
AERAAQEVLSLPMFPELNEDDQARVITALKDLAIAAVQS
Download sequence
Identical sequences A0A0H3K324 Q31S66
gi|56751442|ref|YP_172143.1| gi|81298882|ref|YP_399090.1| WP_011243745.1.45845 WP_011243745.1.5740 WP_011243745.1.95485 1140.Synpcc7942_0071 269084.syc1433_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]