SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011243767.1.95485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243767.1.95485
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily L28p-like 1.35e-26
Family Ribosomal protein L28 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011243767.1.95485
Sequence length 78
Comment MULTISPECIES: 50S ribosomal protein L28 [Synechococcus]; AA=GCF_000012525.1; RF=na; TAX=1140; STAX=32046; NAME=Synechococcus elongatus PCC 7942; strain=PCC 7942; AL=Complete Genome; RT=Major
Sequence
MSRVCQLTGKKANNAYAISHSHRRTKRLQNVNLQEKRIWWPEGNRFVKLRLSTKAIKTLQ
KKGLSAYARELGIDLKRL
Download sequence
Identical sequences Q31S95 Q5N223
gi|81298853|ref|YP_399061.1| gi|56751466|ref|YP_172167.1| WP_011243767.1.45845 WP_011243767.1.5740 WP_011243767.1.95485 1140.Synpcc7942_0042 269084.syc1457_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]