SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011243851.1.45845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011243851.1.45845
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.42e-67
Family Decarboxylase 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011243851.1.45845
Sequence length 240
Comment MULTISPECIES: orotidine-5'-phosphate decarboxylase [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence
MTDLAARDRIIVPLDVPDVEAAITLIDRLPEAQFFKVGLELFVATGSTVLTILKERQKKI
FLDLKLHDIPNTMAGACRSAARYGVDLLTIHATAGKPALEAAQAGAIAGAAAAGVQPPTL
LAVTVLTSLSQQQLTEELHVPEAVPNYVQHLARQAEACGIGGCVCSPQELVVLKTACSDD
FVRVTPGVRPTWAAAGDQQRVMTPQQAIAAGATYLVVGRPITAADDPAAAFQRVCEELTP
Download sequence
Identical sequences Q31K20 Q5N1T9
gi|81301378|ref|YP_401586.1| gi|56751550|ref|YP_172251.1| WP_011243851.1.45845 WP_011243851.1.5740 WP_011243851.1.95485 1140.Synpcc7942_2569 269084.syc1541_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]