SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011275641.1.68328 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011275641.1.68328
Domain Number 1 Region: 63-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.17e-38
Family Tandem AAA-ATPase domain 0.06
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0001
Family Eukaryotic type KH-domain (KH-domain type I) 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011275641.1.68328
Sequence length 315
Comment MULTISPECIES: PhoH family protein [Staphylococcus]; AA=GCF_001235105.1; RF=na; TAX=1283; STAX=1283; NAME=Staphylococcus haemolyticus; strain=F0_34; AL=Scaffold; RT=Major
Sequence
MPGIIQIDDINHSQALIGNNDEHINAIEEAFDVEIHARGQEIAVKGQKIEPVEKSELVLK
NLLKVIEMGNTITLKDVEAAIKMAKNDTIHHLIDLYDEEITKDAYGKTIRAKTMGQRLYV
NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGSVKRIVLTRPAVEAGESLGFLPGDLK
EKVDPYLRPLYDGLNTVLGREQTARFIERGTIEIAPLAYMRGRTLDDAFVILDEAQNTTH
AQMKMFLTRLGFSSKMVVTGDQTQIDLPKGVKSGLKEAVKKLHGVKGINIMQLDQSDVVR
HPLVSKIIDRYEGDI
Download sequence
Identical sequences A0A1F2KU49 A0A2A1KDR1 Q4L6S1
279808.SH1345 WP_011275641.1.10109 WP_011275641.1.101333 WP_011275641.1.101994 WP_011275641.1.1027 WP_011275641.1.10422 WP_011275641.1.11818 WP_011275641.1.1225 WP_011275641.1.12511 WP_011275641.1.12694 WP_011275641.1.13054 WP_011275641.1.1311 WP_011275641.1.1380 WP_011275641.1.14283 WP_011275641.1.14470 WP_011275641.1.14598 WP_011275641.1.15116 WP_011275641.1.15895 WP_011275641.1.16163 WP_011275641.1.16219 WP_011275641.1.16313 WP_011275641.1.18129 WP_011275641.1.18323 WP_011275641.1.18844 WP_011275641.1.19491 WP_011275641.1.1978 WP_011275641.1.19908 WP_011275641.1.20173 WP_011275641.1.20471 WP_011275641.1.20834 WP_011275641.1.20864 WP_011275641.1.21698 WP_011275641.1.22102 WP_011275641.1.23003 WP_011275641.1.2357 WP_011275641.1.23919 WP_011275641.1.25922 WP_011275641.1.26373 WP_011275641.1.28455 WP_011275641.1.28860 WP_011275641.1.29037 WP_011275641.1.297 WP_011275641.1.30324 WP_011275641.1.31052 WP_011275641.1.31288 WP_011275641.1.31494 WP_011275641.1.35058 WP_011275641.1.35706 WP_011275641.1.3637 WP_011275641.1.36410 WP_011275641.1.36612 WP_011275641.1.36734 WP_011275641.1.36837 WP_011275641.1.36913 WP_011275641.1.37394 WP_011275641.1.37871 WP_011275641.1.39200 WP_011275641.1.39440 WP_011275641.1.40163 WP_011275641.1.402 WP_011275641.1.4220 WP_011275641.1.42727 WP_011275641.1.43577 WP_011275641.1.43780 WP_011275641.1.44205 WP_011275641.1.44226 WP_011275641.1.44543 WP_011275641.1.4581 WP_011275641.1.48297 WP_011275641.1.48683 WP_011275641.1.49011 WP_011275641.1.49079 WP_011275641.1.49577 WP_011275641.1.49716 WP_011275641.1.510 WP_011275641.1.51540 WP_011275641.1.51872 WP_011275641.1.51997 WP_011275641.1.52664 WP_011275641.1.53148 WP_011275641.1.53191 WP_011275641.1.53313 WP_011275641.1.54595 WP_011275641.1.55678 WP_011275641.1.5596 WP_011275641.1.58879 WP_011275641.1.589 WP_011275641.1.58915 WP_011275641.1.61337 WP_011275641.1.61390 WP_011275641.1.63295 WP_011275641.1.6358 WP_011275641.1.63725 WP_011275641.1.64661 WP_011275641.1.64835 WP_011275641.1.64863 WP_011275641.1.65972 WP_011275641.1.66148 WP_011275641.1.66202 WP_011275641.1.66833 WP_011275641.1.67078 WP_011275641.1.67111 WP_011275641.1.67157 WP_011275641.1.67271 WP_011275641.1.67478 WP_011275641.1.67846 WP_011275641.1.68076 WP_011275641.1.68328 WP_011275641.1.68612 WP_011275641.1.69277 WP_011275641.1.69544 WP_011275641.1.7082 WP_011275641.1.70824 WP_011275641.1.71127 WP_011275641.1.7114 WP_011275641.1.74301 WP_011275641.1.74446 WP_011275641.1.74601 WP_011275641.1.74627 WP_011275641.1.74640 WP_011275641.1.75368 WP_011275641.1.76890 WP_011275641.1.76990 WP_011275641.1.77553 WP_011275641.1.77591 WP_011275641.1.77635 WP_011275641.1.78694 WP_011275641.1.79350 WP_011275641.1.81145 WP_011275641.1.81188 WP_011275641.1.8193 WP_011275641.1.81983 WP_011275641.1.82096 WP_011275641.1.82332 WP_011275641.1.82878 WP_011275641.1.83289 WP_011275641.1.83870 WP_011275641.1.84269 WP_011275641.1.84838 WP_011275641.1.85768 WP_011275641.1.87015 WP_011275641.1.8732 WP_011275641.1.87507 WP_011275641.1.88266 WP_011275641.1.88267 WP_011275641.1.8871 WP_011275641.1.89180 WP_011275641.1.8934 WP_011275641.1.89666 WP_011275641.1.90039 WP_011275641.1.90558 WP_011275641.1.91141 WP_011275641.1.91567 WP_011275641.1.92193 WP_011275641.1.92210 WP_011275641.1.92713 WP_011275641.1.92797 WP_011275641.1.9312 WP_011275641.1.93353 WP_011275641.1.93901 WP_011275641.1.94858 WP_011275641.1.96210 WP_011275641.1.98145 gi|70726346|ref|YP_253260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]