SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011275925.1.44543 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011275925.1.44543
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000215
Further Details:      
 
Domain Number 2 Region: 297-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.000021
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.73e-30
Family Ribonuclease PH domain 2-like 0.0000703
Further Details:      
 
Domain Number 4 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-27
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 5 Region: 559-644
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 624-699
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.98e-18
Family Cold shock DNA-binding domain-like 0.00065
Further Details:      
 
Domain Number 7 Region: 239-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000017
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011275925.1.44543
Sequence length 700
Comment polyribonucleotide nucleotidyltransferase [Staphylococcus haemolyticus]; AA=GCF_001237405.1; RF=na; TAX=1283; STAX=1283; NAME=Staphylococcus haemolyticus; strain=51-15; AL=Scaffold; RT=Major
Sequence
MSQEKKVFKTEWAGRSLTIEIGQLAKQANGAVLVRYGDTVVLSTAVASKEPRDGDFFPLT
VNYEEKMYAAGKIPGGFKKREGRPGDEATLTARLIDRPIRPLFPKGYRHDVQIMNTVLSA
DPDCSPEMAAMIGSSMALSVSDIPFQGPIAGVNVGYVDGKYVINPTVEEKEVSRLDLEVA
GHKDAVNMVEAGASEITEKEMLEAIFFGHDEIKRLVAFQEEVVAHIQPVKKEFVPVERDE
ALVSRVKTLTEEKGLKETVLTFDKQQRDENLDTLKAEIATEFVDEADPENELLIDEVYAI
LNDLVKEEVRRLIADEKIRPDGRKPDEIRPLESEVGLLPRAHGSGLFTRGQTQALSVLTL
GALGDYQLIDGLGPEQEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
DTTEFPYTVRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREVIEEALEQARQGRLAIMDH
MLQTIDQPRKELSAYAPKVEIMHIKPEKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
IGAIDQDMINRAREIIEDITREAEVGQVYNAKVKRIEKYGAFVELFAGKDALLHISQISK
ERINKVEDVLSIGDSIDVKITEIDKQGRVNASHKALDENK
Download sequence
Identical sequences A0A2A1KCJ5 Q4L5X7
WP_011275925.1.10109 WP_011275925.1.101333 WP_011275925.1.101994 WP_011275925.1.11818 WP_011275925.1.1225 WP_011275925.1.12910 WP_011275925.1.15116 WP_011275925.1.15895 WP_011275925.1.16163 WP_011275925.1.18129 WP_011275925.1.18323 WP_011275925.1.23919 WP_011275925.1.26373 WP_011275925.1.28455 WP_011275925.1.28860 WP_011275925.1.30324 WP_011275925.1.31288 WP_011275925.1.35706 WP_011275925.1.36410 WP_011275925.1.36612 WP_011275925.1.36913 WP_011275925.1.37394 WP_011275925.1.37871 WP_011275925.1.39200 WP_011275925.1.43577 WP_011275925.1.43780 WP_011275925.1.44205 WP_011275925.1.44543 WP_011275925.1.4581 WP_011275925.1.48297 WP_011275925.1.48683 WP_011275925.1.49079 WP_011275925.1.49716 WP_011275925.1.51540 WP_011275925.1.51872 WP_011275925.1.53148 WP_011275925.1.53191 WP_011275925.1.55678 WP_011275925.1.5596 WP_011275925.1.60041 WP_011275925.1.61337 WP_011275925.1.61390 WP_011275925.1.63725 WP_011275925.1.64661 WP_011275925.1.64835 WP_011275925.1.64863 WP_011275925.1.65972 WP_011275925.1.66202 WP_011275925.1.67078 WP_011275925.1.67111 WP_011275925.1.67271 WP_011275925.1.68328 WP_011275925.1.69277 WP_011275925.1.71127 WP_011275925.1.74627 WP_011275925.1.76890 WP_011275925.1.77553 WP_011275925.1.77591 WP_011275925.1.78694 WP_011275925.1.79350 WP_011275925.1.81188 WP_011275925.1.8193 WP_011275925.1.81983 WP_011275925.1.82096 WP_011275925.1.82878 WP_011275925.1.83289 WP_011275925.1.84838 WP_011275925.1.88266 WP_011275925.1.88267 WP_011275925.1.8871 WP_011275925.1.89180 WP_011275925.1.92193 WP_011275925.1.92210 WP_011275925.1.9312 279808.SH1639 gi|70726640|ref|YP_253554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]