SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011277505.1.19907 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011277505.1.19907
Domain Number 1 Region: 65-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.19e-19
Family Cold shock DNA-binding domain-like 0.0000318
Further Details:      
 
Domain Number 2 Region: 153-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00017
Further Details:      
 
Domain Number 3 Region: 6-63
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000000942
Family ECR1 N-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011277505.1.19907
Sequence length 249
Comment RNA-binding protein [Sulfolobus acidocaldarius]; AA=GCF_002215485.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=Y14 16-22; AL=Complete Genome; RT=Major
Sequence
MSQANKIYFEDRSIVTPGDLIAEGEFQVPWSPYYYKVNGKYYSAITGLITVKDGSIFEVI
PLESSRYYPKVGDTIIGLVEDIEIYGWVIDIKSFYSAYLPASSLLGRPISPGEDVRRYLD
VGDYVIAKIEAFDRTISPVLTVKGKGLGRIPLGTVMDIMPVKVPRVIGKNRSMIEVLTSE
SGCEIFVAQNGRIHIKCANNLIEEALIEAINIIQSESHTKGLTERIRNFLKQKLGVIRND
SAPKTEANT
Download sequence
Identical sequences A0A0U2W436 M1IP23 M1JAR2 Q4JB26
WP_011277505.1.100797 WP_011277505.1.13097 WP_011277505.1.15291 WP_011277505.1.18585 WP_011277505.1.18739 WP_011277505.1.19907 WP_011277505.1.20267 WP_011277505.1.24072 WP_011277505.1.28054 WP_011277505.1.29213 WP_011277505.1.30898 WP_011277505.1.31299 WP_011277505.1.3283 WP_011277505.1.33024 WP_011277505.1.33782 WP_011277505.1.34459 WP_011277505.1.34536 WP_011277505.1.35781 WP_011277505.1.35800 WP_011277505.1.36276 WP_011277505.1.37881 WP_011277505.1.38112 WP_011277505.1.38253 WP_011277505.1.39308 WP_011277505.1.39398 WP_011277505.1.43265 WP_011277505.1.4394 WP_011277505.1.45682 WP_011277505.1.48356 WP_011277505.1.49892 WP_011277505.1.50721 WP_011277505.1.51246 WP_011277505.1.5150 WP_011277505.1.53520 WP_011277505.1.55288 WP_011277505.1.55517 WP_011277505.1.56706 WP_011277505.1.57256 WP_011277505.1.64117 WP_011277505.1.64360 WP_011277505.1.67449 WP_011277505.1.68798 WP_011277505.1.7301 WP_011277505.1.74875 WP_011277505.1.78046 WP_011277505.1.78998 WP_011277505.1.8042 WP_011277505.1.83345 WP_011277505.1.87279 WP_011277505.1.90653 WP_011277505.1.90680 WP_011277505.1.95134 WP_011277505.1.96274 WP_011277505.1.97501 gi|449068912|ref|YP_007435993.1| gi|70606426|ref|YP_255296.1| 330779.Saci_0611 gi|449066638|ref|YP_007433720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]