SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011277830.1.45682 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011277830.1.45682
Domain Number 1 Region: 81-158
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.18e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011277830.1.45682
Sequence length 178
Comment RNA-processing protein [Sulfolobus acidocaldarius]; AA=GCF_001481635.1; RF=na; TAX=2285; STAX=2285; NAME=Sulfolobus acidocaldarius; strain=NG05B_CO5_07; AL=Chromosome; RT=Major
Sequence
MYVTVPDERLDLIKTLSKRIEEISNTTINFDEVTKQIRVIPKDNNSYNAMKVISVINALG
FGFEPNDAMRLMSDDYGLEIINLKEFTNSVNSLRRIKGRVIGEKGKTKRTIEEYTGVIVL
VKDHEIGLLGNIEQLSIAKRAIELLIEGKEHNTVYKYLDKAERYAMLSNVNRNLKEGL
Download sequence
Identical sequences A0A0U3H9A1 M1IU87 M1JBV9 Q4JA52
gi|70606751|ref|YP_255621.1| WP_011277830.1.100797 WP_011277830.1.13097 WP_011277830.1.15291 WP_011277830.1.18585 WP_011277830.1.18739 WP_011277830.1.19907 WP_011277830.1.20267 WP_011277830.1.24072 WP_011277830.1.28054 WP_011277830.1.29213 WP_011277830.1.30898 WP_011277830.1.31299 WP_011277830.1.3283 WP_011277830.1.33024 WP_011277830.1.33782 WP_011277830.1.34459 WP_011277830.1.34536 WP_011277830.1.35781 WP_011277830.1.35800 WP_011277830.1.36276 WP_011277830.1.37881 WP_011277830.1.38112 WP_011277830.1.38253 WP_011277830.1.39308 WP_011277830.1.39398 WP_011277830.1.43265 WP_011277830.1.4394 WP_011277830.1.45682 WP_011277830.1.48356 WP_011277830.1.49892 WP_011277830.1.50721 WP_011277830.1.51246 WP_011277830.1.5150 WP_011277830.1.53520 WP_011277830.1.55288 WP_011277830.1.55517 WP_011277830.1.56706 WP_011277830.1.57256 WP_011277830.1.64117 WP_011277830.1.64360 WP_011277830.1.67449 WP_011277830.1.68798 WP_011277830.1.7301 WP_011277830.1.74875 WP_011277830.1.78046 WP_011277830.1.78998 WP_011277830.1.8042 WP_011277830.1.83345 WP_011277830.1.87279 WP_011277830.1.90653 WP_011277830.1.90680 WP_011277830.1.95134 WP_011277830.1.96274 WP_011277830.1.97501 330779.Saci_0966 gi|449066975|ref|YP_007434057.1| gi|449069247|ref|YP_007436328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]