SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011291373.1.72373 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011291373.1.72373
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-86
Family Cgl1923-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011291373.1.72373
Sequence length 313
Comment PAC2 family protein [Thermobifida fusca]; AA=GCF_000401915.1; RF=na; TAX=1169414; STAX=2021; NAME=Thermobifida fusca TM51; strain=TM51; AL=Contig; RT=Major
Sequence
MRDPADLYELRSDLPELSEPVMLVSLDGFVDAGAAGKQAVATLLDGLQHTELATFDIDGL
LDYRSRRPVMIFNETTWVSYAEPKLSLTLLHDLEGTPFLLLHGLEPDRRWEGFTAAVRQL
VERLSVRLTVCFYGIPMAVPHTRPVTATPHATRPELVTEHTPWVGRIQVPGNIMSLLEYR
LGQAGHDVIGYAVHVPSYLAQSEYPRAGLAVLEYIARVTGLVLPTEKLAEEATRVDGEIN
RQVEASEEVQRVVRNLEAQYDNFMAVHNGLDVDALLAGDESRLPTADELGAELERFLAEH
GRGSAEHDRGSEG
Download sequence
Identical sequences Q47RF3
WP_011291373.1.46431 WP_011291373.1.72373 WP_011291373.1.82272 269800.Tfu_0926 gi|72161330|ref|YP_288987.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]