SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011291373.1.82272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011291373.1.82272
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-86
Family Cgl1923-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011291373.1.82272
Sequence length 313
Comment PAC2 family protein [Thermobifida fusca]; AA=GCF_000012405.1; RF=representative genome; TAX=269800; STAX=2021; NAME=Thermobifida fusca YX; strain=YX; AL=Complete Genome; RT=Major
Sequence
MRDPADLYELRSDLPELSEPVMLVSLDGFVDAGAAGKQAVATLLDGLQHTELATFDIDGL
LDYRSRRPVMIFNETTWVSYAEPKLSLTLLHDLEGTPFLLLHGLEPDRRWEGFTAAVRQL
VERLSVRLTVCFYGIPMAVPHTRPVTATPHATRPELVTEHTPWVGRIQVPGNIMSLLEYR
LGQAGHDVIGYAVHVPSYLAQSEYPRAGLAVLEYIARVTGLVLPTEKLAEEATRVDGEIN
RQVEASEEVQRVVRNLEAQYDNFMAVHNGLDVDALLAGDESRLPTADELGAELERFLAEH
GRGSAEHDRGSEG
Download sequence
Identical sequences Q47RF3
gi|72161330|ref|YP_288987.1| 269800.Tfu_0926 WP_011291373.1.46431 WP_011291373.1.72373 WP_011291373.1.82272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]