SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011321897.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011321897.1.57290
Domain Number 1 Region: 64-200,355-493
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.06e-48
Family Tandem AAA-ATPase domain 0.000042
Further Details:      
 
Domain Number 2 Region: 628-760
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 8.31e-28
Family XPF/Rad1/Mus81 nuclease 0.000038
Further Details:      
 
Domain Number 3 Region: 776-838
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000508
Family Hef domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011321897.1.57290
Sequence length 845
Comment Hef nuclease [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MATAAEDTEYIEGPLLAEGLLEKRRYQLKLAETAAEDHTLVCLPTGLGKTAVSLLVTAER
LADRGGKALLLAPTKPLVQQHAAFYREALTLADDEVVVFTGAVRPDDRAALWEDASVVCA
TPQVVENDLVGNRVSLRPVTHLTVDECHRATGDYAYNYIAERYHEDAAKPLVTAMSASPG
GDKEEILTVCDNLGLREVAVMTEADADVDEYTHHTDVEWERVELPEAVIDIRDNLNEVIT
ERLTKLKELGVTTSTDPNMSQSQLNAIRAKLQELINNDDSSGYKGMSAHAEIMKLRRAVE
LVETQSVESVRRYFERQREDAKSSGASKASQRFVSEPRVQAAMRKATAFDDLHPKFRRTR
ILLAQTLGIEGGERVIVFTESRDTAESLTAFLGEHFETRRFVGQGDKDGSDGMTQTEQKE
TLDAFRSGEFEVLVSTSVAEEGLDVPDVDLVLFYEPVPKGIRSIQRKGRTGRASDGRVVV
LLAEDTRDEAFFWMSRNEEKRMEEELRKLKSIEGEIEAEIAQADLGSFAEAPPEGSEESE
HTAEDEAESGEAEPPDSGGGESNDGNQAETSGDTAEVAPDTDSNGGDAAEPAEDADRQVG
LTDFAAEADGTDTDEAGTVATAAPEGETVEIVADQRELDSHIARDLSMRDGVETRLETLA
VGDYVLSDRVVVERKAVEDFLETLVGGDRSMFEQVGAAARHYGRPVVIIEGEGLYERRNV
HPNAIRGAVASLAVDFGASVLRTTDTDETADLLEVIATREQETDDRSVSVHGEKGGKTLA
EKQEYVVSAVAEVGPVTARALLEHFGSVEAVMSADEEALQAVDGVGDVTAERIRDVTGTT
YADSS
Download sequence
Identical sequences A0A1U7ETL9
gi|76800822|ref|YP_325830.1| 348780.NP0336A WP_011321897.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]