SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322009.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322009.1.57290
Domain Number 1 Region: 47-284,317-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-46
Family Tandem AAA-ATPase domain 0.00032
Further Details:      
 
Domain Number 2 Region: 545-705
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.09e-20
Family Achaeal helicase C-terminal domain 0.023
Further Details:      
 
Domain Number 3 Region: 426-518
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000435
Family RecQ helicase DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011322009.1.57290
Sequence length 803
Comment DEAD/DEAH box helicase [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MSLPPPASFVASRTEYEPGTPVEAVFPSFAEAFPFESFNRMQSAALPAIADRDDNVVVSA
PTASGKTALAEAAICRTLDAGGTALFLAPLRALTNEKESEWERFESLGYSVYVVTGERDL
DPRRAERADILVMTPEKADSATRKHDSPRYAFITDIDCCVIDEVHLLDSDRRGAVLEVTV
SRLRRLCDPRVVALSATMQNVDDVAAWLDAPPESTFEFGDDYRPVPLSATVETYAHGDNA
FADKYRRLYRALDLAEPHINEGGQALVFVASRQDTVRAAEKARDELAERDIDIGARGDYD
FHTDAAELENDTLRKSVVDGVGFHHAGLSKADKDRVEEWFKQGKIQLLFSTSTLAWGVNL
PARCVVIRDTKLHDPLEGEVDISPLDILQMLGRAGRPGYDDAGYAHIVCDGSDADKYRQL
LRDGKPIESRLAETLDSHLNAEIALGVVDDIDDVLSWLETTFYYARAQSAPGKYEAGDSL
RDRVSATLERLVDGGFVDQSGLNIEPTGLGRLTSQFYLQLNTAESFDALCQRAASNESPP
IDESTVLRAVADAAAFDSVSARRDEREAFEAVLGHEGDDLDDGNRKVLAILRAGMDGTTP
GELQSDAWVIRRNARRLLAALRAFCERFADPRDANLVRRIEARIEHGVSDDTVGLVAIEG
VGTGRAQTLAEAGIDSPAAVRAAGVDGLRKAGLSESVAERIHEQARDLPALDFDWKDIPD
RIRHGENTMGEVTIKNAGGGEPAGIRVTVNGVEMTQQTSYLGEATVPVGVFGGDAETLTY
EVEVAFPNLPLRPVVDSRTVDVA
Download sequence
Identical sequences 348780.NP0564A WP_011322009.1.57290 gi|76800934|ref|YP_325942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]