SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322154.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322154.1.57290
Domain Number 1 Region: 349-575
Classification Level Classification E-value
Superfamily PHP domain-like 1.44e-44
Family PHP domain 0.00073
Further Details:      
 
Domain Number 2 Region: 159-327
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.74e-36
Family DNA polymerase beta-like 0.0063
Further Details:      
 
Domain Number 3 Region: 3-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000000406
Family DNA polymerase beta, N-terminal domain-like 0.004
Further Details:      
 
Domain Number 4 Region: 94-147
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000477
Family DNA helicase RuvA subunit, middle domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011322154.1.57290
Sequence length 580
Comment DNA polymerase/3'-5' exonuclease PolX [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MSRNADVAALLEEMAAHLEARDVDYKPNVYRRAAESIRGHTVAVETLYEEGGEDALTEID
DVGDAIAGKTAEYIETGDIEELADLREGLPVEMDALTAVEGVGPKTVASLYDALEIETLD
DLEAAAEAGEIQTVSGFGEKTEQNILKNIPFARESRARSLLGEARPLADRIVEYVESMPV
AEAVETAGSIRRWRPTVGDVDVLVGSADREAVIEAFTDWPAADAVIEAGTNKASVRSNGV
RVDLRVVDPDSFGAALQYFTGSKDHNVAVRNRAIDHDLKLNEYGVFDISDIDDPDAGQRV
GDRVAGESEAGVYEAVGMAWVPPEIRENRGEVDAAAEESLPDLLEEADIRGDLHLHTTAS
DGQTSVEGMAEAAAEYGHEYIAVADHATGPGMVGGVGLTDEELFDLRETVRAVDDSASID
VFAGVEANIGEDGSISVSEDVLEALDCVVASPHSGLDGDGTDRLVAAIEHPEVDIIGHPT
GRLLNQRPGHDVDIERVASAAADSDTALEINANPHRLDLRSSYVKAAIEAGATIAINTDA
HRPGAYDYMRFGVHTGRRGWAEPDDVLNCRDSDGVRAFLE
Download sequence
Identical sequences A0A1U7EU92
gi|76801079|ref|YP_326087.1| WP_011322154.1.57290 348780.NP0854A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]