SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322168.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322168.1.57290
Domain Number 1 Region: 23-340
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 3.52e-106
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000289
Further Details:      
 
Domain Number 2 Region: 425-602
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.5e-53
Family NAD+-dependent DNA ligase, domain 3 0.0000999
Further Details:      
 
Domain Number 3 Region: 343-421
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.02e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00053
Further Details:      
 
Domain Number 4 Region: 610-685
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000748
Family DNA ligase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011322168.1.57290
Sequence length 691
Comment DNA ligase (NAD(+)) LigA [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MEEPEDNPYIRDPPLDFEPVDELDAASATRQVETLREAIRFHDYRYYQLADPVISDRAYD
QLFERLERLESKFDRSSATSPTQRVGGEPLDELETVEHVAPMRSIESSVEVDDIRDFDTR
IQERLAAAGYEGPVRYLCEPKFDGLSVELVYEEGELSRAATRGDGQEGDDVTANVRTIRS
VPLTLDGDCPSFLAVRGEIFMPKDAFQEYNRERLERGEEPFSNPRNAAAGTLRQLDPSVT
AERPLDCFVFDILDDGGRGFETRMAEHEAVESWGFQVDDHTARVDDIEAAIAFREEMLDG
RASLDYEIDGIVIKLDRKDACALLGATARAPRWAYAYKFPARTEETTVRDIVLQVGRTGR
LTPVALLDPVEVSGVEVSRATLHNPQQIAELGVGIGDRVTLKRAGDVIPYIEAVVDSERE
AHFEFPDRCPVCESPLERDGPLAYCTGGVACPAQLRRAVEHYASRSGLDIEGLGESAVDQ
LVDAGLVERLPDLYDLSVADVAELDGWGRTSAENLLEELEASTEPPLPAFLSALGIPGVG
TTTAADIAREFGTLDAVMDATAEELRAVDGIGPTLGGEIAEFFDSDRNQQVIEQLRKRGV
DPEPAETAGDALSGQTFVFTGSLDGLTREEAHELVETSGGTATGSVSGNTDYLVVGDSPG
QRKREAANEHGVETLSQSDFESLLESHGIEI
Download sequence
Identical sequences Q3ITK1
gi|76801093|ref|YP_326101.1| 348780.NP0882A WP_011322168.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]