SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322270.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322270.1.57290
Domain Number 1 Region: 494-572
Classification Level Classification E-value
Superfamily RuvA domain 2-like 3.02e-17
Family Hef domain-like 0.078
Further Details:      
 
Domain Number 2 Region: 17-96
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 5.23e-17
Family GIY-YIG endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 184-234
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000575
Family C-terminal UvrC-binding domain of UvrB 0.01
Further Details:      
 
Weak hits

Sequence:  WP_011322270.1.57290
Domain Number - Region: 439-470
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0981
Family Diacylglycerol kinase-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011322270.1.57290
Sequence length 575
Comment excinuclease ABC subunit C [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MDASAVRKRAAELPAEPGVYQFEAGESVLYVGKAVDLRERVRSYVAPRSDRIRRMVEAAA
AVDFAVTDTETQALLLEANLIKRHQPRYNVRLKDDKSYPLVQLTAHEAPRIEITRTPDEA
ATVFGPYTDKSRVETVVKALRETYELRGCSDHKYEGRDRPCLDYELGLCSAPCTGEIDTD
AYAEDVESARRFFDGETGVLAEPLRREMETAAASQAFERAASLRDRLEAVETFHEGGSEA
VSGRGGRRLDVLGVAVEGESATVARLRSEDGKLVERDRHRVDAPADAESVPSVLAAFIPQ
FYAERSLPDVLLLSERYDDEELDQWLHAEGVDIRVPGAGRAATLVELALKNARRTTAEAD
GPTALARRLGIDRPERIEGFDVSHAGGKDAVGSNVVFVDGSPETADYRRRSLDDENDDYA
NMRRLVRWRATRAVEGRDDRPTPDLLLIDGGDGQLGAAQDALAETGWDVPAIALAKADEL
VVTSDGVADWDDGPALRLLQRVRDEAHRFAVQYHQQVRDAVSTPLDSVPGVGPELRERLL
KRFGTVDGVRSASREELERVDGVGEDTAAAIDAAL
Download sequence
Identical sequences Q3ITA0
gi|76801195|ref|YP_326203.1| 348780.NP1086A WP_011322270.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]